General Information

  • ID:  hor002146
  • Uniprot ID:  P41694
  • Protein name:  Preptin
  • Gene name:  IGF2
  • Organism:  Neovison vison (American mink) (Mustela vison)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Neogale (genus), Mustelinae (subfamily), Mustelidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSAQRL
  • Length:  34
  • Propeptide:  MGVPMGKSLLAPLTFLALASCCFAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSAQRLRR
  • Signal peptide:  MGVPMGKSLLAPLTFLALASCCFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Mechanism:  The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41694-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002146_AF2.pdbhor002146_ESM.pdb

Physical Information

Mass: 458827 Formula: C186H273N47O52
Absent amino acids: CEHIM Common amino acids: P
pI: 9.12 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -77.94 Boman Index: -6917
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 51.47
Instability Index: 3572.06 Extinction Coefficient cystines: 8480
Absorbance 280nm: 256.97

Literature

  • PubMed ID:  7686523
  • Title:  Insulin-like growth factor II in the mink (Mustela vison): determination of a cDNA nucleotide sequence and developmental regulation of its expression.